Glucagon Like Peptide 1 (GLP-1, amide, human) - FAM labeled
Catalog #:
ABBFO2034Shipping advice for credit card purchase:
Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details
ABBFO2034-1mg | USD339.0 |
Synonyms: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Functional Activity:
This is a fluorescent (FAM)-labeled Glucagon-like peptide, Abs/Em=494/521 nm.
Technical Data:
M.Wt: 4469.8
Sequence (one-letter code): FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence (three-letter code): FAM - His - Asp - Glu - Phe - Glu - Arg - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
Excitation (nm): 494
Emission (nm): 521
Solubility: Soluble in DMSO
Purity: >95% (HPLC)
Shipping Conditions: Room temperature
Storage: Store and desiccate at -20°C and protect from light.
Related Products by Target:
References for Glucagon Like Peptide 1 (GLP-1, amide, human) - FAM labeled :
Certificate of Analysis/MSDS is available upon request
For bulk or custom order please contact us for details