Galanin Lys (Biotin)(human) - FAM labeled

Catalog #:

Shipping advice for credit card purchase:

Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details

Synonyms: FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)

Functional Activity:

This is a N-terminus fluorescent (FAM)-labeled and C-terminus biotinylated Galanin peptide, Abs/Em=494/521nm.

Technical Data:

M.Wt: 3870.2

Sequence (one-letter code): FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)

Sequence (three-letter code): FAM - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - Lys(Biotin) - OH

Excitation (nm): 494

Emission (nm): 521

Solubility: Soluble in DMSO

Purity: >95% (HPLC)

Shipping Conditions: Room temperature

Storage: Store and desiccate at -20°C and protect from light.

Related Products by Target:

References for Galanin Lys (Biotin)(human) - FAM labeled :

Certificate of Analysis/MSDS is available upon request

For bulk or custom order please contact us for details