Exendin 4 - FAM labeled

Catalog #:

Shipping advice for credit card purchase:

Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details

Synonyms: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Functional Activity:

This is a fluorescent (FAM)-labeled Exendin 4, Abs/Em = 494/519 nm.

Technical Data:

M.Wt: 4545.0

Sequence (one-letter code): FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Sequence (three-letter code): FAM - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2

Excitation (nm): 494

Emission (nm): 519

Solubility: Soluble in DMSO

Purity: >95% (HPLC)

Shipping Conditions: Room temperature

Storage: Store and desiccate at -20°C and protect from light.

Related Products by Target:

References for Exendin 4 - FAM labeled :

Certificate of Analysis/MSDS is available upon request

For bulk or custom order please contact us for details