Exendin 4 - FAM labeled
Catalog #:
ABBFO2029Shipping advice for credit card purchase:
Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details
ABBFO2029-1mg | USD509.0 |
Synonyms: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Functional Activity:
This is a fluorescent (FAM)-labeled Exendin 4, Abs/Em = 494/519 nm.
Technical Data:
M.Wt: 4545.0
Sequence (one-letter code): FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence (three-letter code): FAM - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
Excitation (nm): 494
Emission (nm): 519
Solubility: Soluble in DMSO
Purity: >95% (HPLC)
Shipping Conditions: Room temperature
Storage: Store and desiccate at -20°C and protect from light.
Related Products by Target:
References for Exendin 4 - FAM labeled :
Certificate of Analysis/MSDS is available upon request
For bulk or custom order please contact us for details