Glucagon (1 - 29)(bovine, human, porcine) - FAM labeled
Catalog #:
ABBFO2033Shipping advice for credit card purchase:
Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details
| ABBFO2033-1mg | USD179.0 |
Synonyms: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Functional Activity:
This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm.
Technical Data:
M.Wt: 3841.1
Sequence (one-letter code): FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Sequence (three-letter code): FAM - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - OH
Excitation (nm): 494
Emission (nm): 521
Solubility: Soluble in DMSO
Purity: >95% (HPLC)
Shipping Conditions: Room temperature
Storage: Store and desiccate at -20°C and protect from light.
Related Products by Target:
References for Glucagon (1 - 29)(bovine, human, porcine) - FAM labeled :
Certificate of Analysis/MSDS is available upon request
For bulk or custom order please contact us for details

