Parathyroid Hormone (1 - 34) (human) - FAM labeled

Catalog #:

Shipping advice for credit card purchase:

Suitable for Two-Day Shipping (2-3 Days). For international shipping rate please contact us for details

Synonyms: FAM-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Functional Activity:

This is a fluorescent (FAM)-labeled PTH peptide, Abs/Em=492/518 nm.

Technical Data:

M.Wt: 4476.1

Sequence (one-letter code): FAM-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Sequence (three-letter code): FAM - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH

Excitation (nm): 492

Emission (nm): 518

Solubility: Soluble in DMSO

Purity: >95% (HPLC)

Shipping Conditions: Room temperature

Storage: Store and desiccate at -20°C and protect from light.

Related Products by Target:

References for Parathyroid Hormone (1 - 34) (human) - FAM labeled :

Certificate of Analysis/MSDS is available upon request

For bulk or custom order please contact us for details